PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 298aa    MW: 33565.7 Da    PI: 6.5183
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629649.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.66.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+lv+++k++G g+W++ ++  g+ R++k+c++rw +yl
   XP_009629649.1 14 KGPWTPEEDEKLVEYIKKYGHGSWRSLPNLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.21.2e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
   XP_009629649.1  67 RGPFSPEEEKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.764965IPR017930Myb domain
SuperFamilySSF466897.86E-3211108IPR009057Homeodomain-like
SMARTSM007172.8E-151363IPR001005SANT/Myb domain
PfamPF002493.3E-171461IPR001005SANT/Myb domain
CDDcd001676.31E-121661No hitNo description
Gene3DG3DSA:1.10.10.606.8E-2665116IPR009057Homeodomain-like
SMARTSM007179.5E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.30466116IPR017930Myb domain
PfamPF002491.0E-1467112IPR001005SANT/Myb domain
CDDcd001671.56E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRTPCCDKK GLKKGPWTPE EDEKLVEYIK KYGHGSWRSL PNLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF SPEEEKLVIQ LHGILGNRWA AIASQLPGRT DNEIKNLWNT HLKKRLFSMG  120
IDPLTHEPSN GLLRRPPTST SARHMAQWES ARLEAEARLS RESQLLVPSS AGRSETDYFL  180
RIWNSEIGEA FRKFKNEDKC LSPASQVSSS TKYGSASGIT TEMDLTLVED TEWKDSQPYT  240
EDIFQGSDTS SSSELEDSSE SALQLLLDFP SNNDMSFLGF LSESSLNCSL AEHRVGFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754443e-55HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629649.10.0PREDICTED: transcription factor MYB28-like
TrEMBLK4C1151e-171K4C115_SOLLC; Uncharacterized protein
STRINGSolyc05g048830.2.11e-171(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-115myb domain protein 17